Protein Info for KEDOAH_08445 in Escherichia coli ECRC99

Name: dpaL
Annotation: diaminopropionate ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 227 to 245 (19 residues), see Phobius details TIGR03528: diaminopropionate ammonia-lyase" amino acids 6 to 392 (387 residues), 650.9 bits, see alignment E=5.3e-200 TIGR01747: diaminopropionate ammonia-lyase family" amino acids 23 to 391 (369 residues), 696.9 bits, see alignment E=5.6e-214 PF00291: PALP" amino acids 41 to 352 (312 residues), 153.4 bits, see alignment E=4.4e-49

Best Hits

Swiss-Prot: 100% identical to DPAL_ECO57: Diaminopropionate ammonia-lyase (ygeX) from Escherichia coli O157:H7

KEGG orthology group: K01751, diaminopropionate ammonia-lyase [EC: 4.3.1.15] (inferred from 100% identity to eco:b2871)

MetaCyc: 100% identical to 2,3-diaminopropionate ammonia-lyase (Escherichia coli K-12 substr. MG1655)
Diaminopropionate ammonia-lyase. [EC: 4.3.1.15]

Predicted SEED Role

"Diaminopropionate ammonia-lyase (EC 4.3.1.15)" (EC 4.3.1.15)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>KEDOAH_08445 diaminopropionate ammonia-lyase (Escherichia coli ECRC99)
MSVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVK
KILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTD
GNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQ
QHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGV
LGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVNVGGDMATIMAGLACGEPNPLGWE
ILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLM
EKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVAP