Protein Info for KEDOAH_08345 in Escherichia coli ECRC99

Name: escR
Annotation: EscR/YscR/HrcR family type III secretion system export apparatus protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 27 (4 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 154 to 182 (29 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 7 to 210 (204 residues), 260.9 bits, see alignment E=4.1e-82 PF00813: FliP" amino acids 10 to 210 (201 residues), 207.8 bits, see alignment E=7.7e-66

Best Hits

Swiss-Prot: 68% identical to SPAP_SALTY: Surface presentation of antigens protein SpaP (spaP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 98% identity to eck:EC55989_3148)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>KEDOAH_08345 EscR/YscR/HrcR family type III secretion system export apparatus protein (Escherichia coli ECRC99)
MSNSISLIAILSLFTLLPFIIASGTSFIKFSIVFVIVRNALGLQQVPSNMTLNGVALLLS
MFVMMPVGKEIYYNSQNENLSFNNVASVVNFVETGMSGYKSYLIKYSEPELVSFFEKIQK
VNSSEDNEEIIDDDNISIFSLLPAYALSEIKSAFIIGFYIYLPFVVVDLVISSVLLTLGM
MMMSPVTISTPIKLILFVAMDGWTMLSKGLILQYFDLSINP