Protein Info for KEDOAH_07640 in Escherichia coli ECRC99

Name: rpoS
Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 1 to 224 (224 residues), 115.5 bits, see alignment E=1.9e-37 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 1 to 235 (235 residues), 417.6 bits, see alignment E=2.8e-129 PF04542: Sigma70_r2" amino acids 1 to 70 (70 residues), 81.5 bits, see alignment E=4.7e-27 PF04539: Sigma70_r3" amino acids 81 to 155 (75 residues), 75.8 bits, see alignment E=3.6e-25 PF04545: Sigma70_r4" amino acids 169 to 222 (54 residues), 56 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to efe:EFER_0328)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>KEDOAH_07640 RNA polymerase sigma factor RpoS (Escherichia coli ECRC99)
MIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQT
IERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRML
RLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREV
LARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE