Protein Info for KEDOAH_07595 in Escherichia coli ECRC99

Name: flhA
Annotation: formate hydrogenlyase transcriptional activator FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 PF13185: GAF_2" amino acids 202 to 345 (144 residues), 34.1 bits, see alignment E=1e-11 PF13492: GAF_3" amino acids 202 to 346 (145 residues), 40 bits, see alignment E=1.8e-13 PF01590: GAF" amino acids 202 to 344 (143 residues), 47.3 bits, see alignment E=1.1e-15 PF00158: Sigma54_activat" amino acids 381 to 548 (168 residues), 242.5 bits, see alignment E=6.8e-76 PF14532: Sigma54_activ_2" amino acids 382 to 552 (171 residues), 77.6 bits, see alignment E=3.9e-25 PF07728: AAA_5" amino acids 405 to 529 (125 residues), 31.3 bits, see alignment E=6.7e-11 PF00004: AAA" amino acids 405 to 523 (119 residues), 23.4 bits, see alignment E=2.6e-08

Best Hits

Swiss-Prot: 100% identical to FHLA_ECOLI: Formate hydrogenlyase transcriptional activator FhlA (fhlA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2731)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (692 amino acids)

>KEDOAH_07595 formate hydrogenlyase transcriptional activator FlhA (Escherichia coli ECRC99)
MSYTPMSDLGQQGLFDITRTLLQQPDLASLCEALSQLVKRSALADNAAIVLWQAQTQRAS
YYASREKDTPIKYEDETVLAHGPVRSILSRPDTLHCSYEEFCETWPQLAAGGLYPKFGHY
CLMPLAAEGHIFGGCEFIRYDDRPWSEKEFNRLQTFTQIVSVVTEQIQSRVVNNVDYELL
CRERDNFRILVAITNAVLSRLDMDELVSEVAKEIHYYFDIDDISIVLRSHRKNKLNIYST
HYLDKQHPAHEQSEVDEAGTLTERVFKSKEMLLINLHERDDLAPYERMLFDTWGNQIQTL
CLLPLMSGDTMLGVLKLAQCEEKVFTTTNLNLLRQIAERVAIAVDNALAYQEIHRLKERL
VDENLALTEQLNNVDSEFGEIIGRSEAMYSVLKQVEMVAQSDSTVLILGETGTGKELIAR
AIHNLSGRNNRRMVKMNCAAMPAGLLESDLFGHERGAFTGASAQRIGRFELADKSSLFLD
EVGDMPLELQPKLLRVLQEQEFERLGSNKIIQTDVRLIAATNRDLKKMVADREFRSDLYY
RLNVFPIHLPPLRERPEDIPLLAKAFTFKIARRLGRNIDSIPAETLRTLSNMEWPGNVRE
LENVIERAVLLTRGNVLQLSLPDIALPEPETPPAATVVAQEGEDEYQLIVRVLKETNGVV
AGPKGAAQRLGLKRTTLLSRMKRLGIDKSALI