Protein Info for KEDOAH_07500 in Escherichia coli ECRC99

Name: hypF
Annotation: carbamoyltransferase HypF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 PF00708: Acylphosphatase" amino acids 10 to 79 (70 residues), 57.5 bits, see alignment E=2.8e-19 TIGR00143: carbamoyltransferase HypF" amino acids 11 to 738 (728 residues), 1054.1 bits, see alignment E=0 PF07503: zf-HYPF" amino acids 108 to 141 (34 residues), 58.9 bits, see alignment (E = 6.6e-20) amino acids 158 to 190 (33 residues), 58.6 bits, see alignment (E = 8.6e-20) PF01300: Sua5_yciO_yrdC" amino acids 210 to 373 (164 residues), 140.1 bits, see alignment E=1.1e-44 PF17788: HypF_C" amino acids 390 to 486 (97 residues), 112.6 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 98% identical to HYPF_ECOLI: Carbamoyltransferase HypF (hypF) from Escherichia coli (strain K12)

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 98% identity to eco:b2712)

MetaCyc: 98% identical to carbamoyl--[HypE] ligase (Escherichia coli K-12 substr. MG1655)
6.2.1.-

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (750 amino acids)

>KEDOAH_07500 carbamoyltransferase HypF (Escherichia coli ECRC99)
MAKNTSCGVQLRIRGKVQGVGFRPFVWQLAQQLNLHGDVCNDGDGVEVRLLEDPETFLVQ
LHQHCPPLARIDSVEREPFIWSQLPTEFTIRQSAGGAMNTQIVPDAATCPACLAEMNTPG
ERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVA
CPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLR
ARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVM
LPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMD
DSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLG
DLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHA
AACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGD
LAAKQPWRNLLAQCLRFVPEWQNYPETASVQQQNWSVLARAIERGINAPLASSCGRLFDA
VAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAP
VNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFP
QSLPAGDGGLSLGQGVIAAARWLAGEVQNG