Protein Info for KEDOAH_07425 in Escherichia coli ECRC99

Name: recX
Annotation: recombination regulator RecX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF21982: RecX_HTH1" amino acids 16 to 37 (22 residues), 27.3 bits, see alignment (E = 4.3e-10) PF02631: RecX_HTH2" amino acids 70 to 110 (41 residues), 54.8 bits, see alignment E=1.3e-18 PF21981: RecX_HTH3" amino acids 118 to 160 (43 residues), 35.5 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 100% identical to RECX_ECO81: Regulatory protein RecX (recX) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K03565, regulatory protein (inferred from 99% identity to eco:b2698)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>KEDOAH_07425 recombination regulator RecX (Escherichia coli ECRC99)
MTESTSRRPAYARLLDRAVRILAVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVI
AWCHEHGYLDDSRFVARFIASRSRKGYGPARIRQELNQKGISREATEKAMRECDIDWCAL
ARDQATRKYGEPLPTVFSEKVKIQRFLLYRGYLMEDIQDIWRNFAD