Protein Info for KEDOAH_07365 in Escherichia coli ECRC99

Name: luxS
Annotation: S-ribosylhomocysteine lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF02664: LuxS" amino acids 4 to 152 (149 residues), 200.4 bits, see alignment E=6.8e-64

Best Hits

Swiss-Prot: 100% identical to LUXS_ECO5E: S-ribosylhomocysteine lyase (luxS) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K07173, S-ribosylhomocysteine lyase [EC: 4.4.1.21] (inferred from 99% identity to eco:b2687)

MetaCyc: 99% identical to S-ribosylhomocysteine lyase (Escherichia coli K-12 substr. MG1655)
S-ribosylhomocysteine lyase. [EC: 4.4.1.21]

Predicted SEED Role

"S-ribosylhomocysteine lyase (EC 4.4.1.21) / Autoinducer-2 production protein LuxS" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>KEDOAH_07365 S-ribosylhomocysteine lyase (Escherichia coli ECRC99)
MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF
AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADVWKAAMEDVLKVQDQNQI
PELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI