Protein Info for KEDOAH_05440 in Escherichia coli ECRC99

Name: yfcH
Annotation: Epimerase family protein YfcH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR01777: TIGR01777 family protein" amino acids 3 to 292 (290 residues), 363.7 bits, see alignment E=4.2e-113 PF01370: Epimerase" amino acids 3 to 215 (213 residues), 92.8 bits, see alignment E=4.6e-30 PF16363: GDP_Man_Dehyd" amino acids 5 to 132 (128 residues), 28.5 bits, see alignment E=2.2e-10 PF13460: NAD_binding_10" amino acids 7 to 116 (110 residues), 38.8 bits, see alignment E=1.9e-13 PF08338: DUF1731" amino acids 249 to 295 (47 residues), 67.5 bits, see alignment 1.4e-22

Best Hits

Swiss-Prot: 99% identical to YFCH_ECOLI: Epimerase family protein YfcH (yfcH) from Escherichia coli (strain K12)

KEGG orthology group: K07071, (no description) (inferred from 99% identity to eco:b2304)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>KEDOAH_05440 Epimerase family protein YfcH (Escherichia coli ECRC99)
MNIVITGGTGLIGRHLIPRLLELGHQITVMTRNPQKASSVLGPRVTLWQGLADQSNLNGI
DAVINLAGEPIADKRWTHEQKERLCQSRWNITQKLVDLINASDTPPSVLISGSATGYYGD
LGEVVVTEEEPPHNKFTHKLCARWEEIACRAQSDKTRVCLLRTGVVLAPDGGILGKMLPP
FRLGLGGPIGSGRQYLAWIHIDDMVNGILWLLDNELRGPFNMVSPYPIRNEQFAHALGHA
LHRPAILRVPATAIRLLMGESSVLVLGGQRALPKRLEEAGFAFRWYDLEEALADVVR