Protein Info for KEDOAH_04745 in Escherichia coli ECRC99

Name: fruB
Annotation: fused PTS fructose transporter subunit IIA/HPr protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 5 to 308 (304 residues), 328.9 bits, E=2.4e-102
• TIGR03828: 1-phosphofructokinase
  • amino acids 5 to 308 (304 residues), 337 bits, E=8.6e-105
• PF00294: PfkB
  • amino acids 14 to 293 (280 residues), 244.4 bits, E=9.1e-77

Best Hits

Swiss-Prot: 100% identical to K1PF_ECOLI: 1-phosphofructokinase (fruK) from Escherichia coli (strain K12)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 100% identity to eco:b2168)

MetaCyc: 100% identical to 1-phosphofructokinase (Escherichia coli K-12 substr. MG1655)
1-phosphofructokinase. [EC: 2.7.1.56]

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• galactitol degradation (5/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
• N-acetyl-D-galactosamine degradation (4/5 steps found)
• fructose degradation (1/1 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Protein Sequence (312 amino acids)

>KEDOAH_04745 fused PTS fructose transporter subunit IIA/HPr protein (Escherichia coli ECRC99)
MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGG
FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPADWER
FVTDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA
PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLGAEGALWVNASGEWIA
KPPSVDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDRPQLA
AMMARVDLQPFN