Protein Info for KEDOAH_04720 in Escherichia coli ECRC99

Name: yeiL
Annotation: Regulatory protein YeiL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00027: cNMP_binding" amino acids 35 to 119 (85 residues), 52.5 bits, see alignment E=4.1e-18

Best Hits

Swiss-Prot: 100% identical to YEIL_ECOLI: Regulatory protein YeiL (yeiL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_3299)

Predicted SEED Role

"Predicted N-ribosylNicotinamide CRP-like regulator" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>KEDOAH_04720 Regulatory protein YeiL (Escherichia coli ECRC99)
VKEIHNNDLKQQLMSESAFKDCFLTDVSADTRLFHFLARDYIVQEGQQPSWLFYLTRGRA
RLYATLANGRVSLIDFFAAPCFIGEIELIDKDHEPRAVQAIEECWCLALPMKHYRPLLLN
DTLFLRKLCVTLSHKNYRNIVSLTQNQSFPLVNRLAAFILLSQEGDLYHEKHTQAAEYLG
VSYRHLLYVLAQFIHDGLLIKSKKGYLIKNRKQLSGLALEMDPENKFSGMMQ