Protein Info for KEDOAH_04705 in Escherichia coli ECRC99

Name: yeiI
Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13412: HTH_24
  • amino acids 1 to 48 (48 residues), 40.3 bits, 2.9e-14
• PF08279: HTH_11
  • amino acids 4 to 49 (46 residues), 21.2 bits, 3.4e-08
• PF00294: PfkB
  • amino acids 58 to 347 (290 residues), 230.8 bits, E=3.8e-72

Best Hits

Swiss-Prot: 98% identical to YEII_ECOLI: Uncharacterized sugar kinase YeiI (yeiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_3296)

MetaCyc: 42% identical to pseudouridine kinase (Escherichia coli UTI89)
Pseudouridine kinase. [EC: 2.7.1.83]

Predicted SEED Role

"Uncharacterized sugar kinase YeiI"

MetaCyc Pathways

• pseudouridine degradation (2/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.83

Use Curated BLAST to search for 2.7.1.83

Protein Sequence (362 amino acids)

>KEDOAH_04705 sugar kinase (Escherichia coli ECRC99)
MNNREKEILAILRRNPLIQQNEIADMLQISRSRVAAHIMDLMRKGRIKGKGYILTEQEYC
VVVGTINMDIRGMADIRYPQSASHPGTIHCSAGGVGRNIAHNLALLGRDVHLLSVIGDDF
YGEMLLEETRRAGVNVSGCVRLHGQSTSTYLAIANRDDETVLAINDTHLLEQLSPQLLNG
SRDLLRHAGVVLADCNLTAEALEWVFTLAGEIPVFVDTVSEFKAGKIKHWLAHIHTLKPT
LPELEILWGQAITSDADRNAAVNALHQQGVQQLFVYLPDESVYCSEKDGEQFLLTAPAHT
TVDSFGADDGFMAGLVYSFLEGNNFRDSARFAMACAAISRASGSLNNPPLSADNALSLVP
MV