Protein Info for KEDOAH_04605 in Escherichia coli ECRC99

Name: yohJ
Annotation: UPF0299 membrane protein YohJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03788: LrgA
  • amino acids 23 to 113 (91 residues), 100 bits, E=3.1e-33

Best Hits

Swiss-Prot: 100% identical to YOHJ_ECO5E: UPF0299 membrane protein YohJ (yohJ) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K06518, holin-like protein (inferred from 99% identity to eco:b2141)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Protein Sequence (132 amino acids)

>KEDOAH_04605 UPF0299 membrane protein YohJ (Escherichia coli ECRC99)
MSKTLNIIWQYLRAFVLIYACLYAGIFIASLLPVTIPGSIIGMLILFVLLALQILPAKWV
NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFLVVSWSSQLVHG
ERKVVGQKGSEE