Protein Info for KEDOAH_04585 in Escherichia coli ECRC99

Name: ycgM
Annotation: 5-carboxymethyl-2-hydroxymuconate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF01557: FAA_hydrolase" amino acids 27 to 232 (206 residues), 183.5 bits, see alignment E=2.3e-58

Best Hits

Swiss-Prot: 40% identical to FAHD1_DICDI: Acylpyruvase FAHD1, mitochondrial (fahd1) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 100% identity to eok:G2583_2680)

MetaCyc: 56% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2 or 3.7.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>KEDOAH_04585 5-carboxymethyl-2-hydroxymuconate isomerase (Escherichia coli ECRC99)
MTQYVFEPQAPVTVPVVGSDEQFPVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADA
VVPVAAGETLALPYPAQTDNYHYEIELVVAIGKKGSDIPLEHAHEYVWGYATGLDMTRRD
RQMEMRQMGRPWEIGKAFDLSAPIAPLHKARDIGGIDNAPIWLQVNGEDHQRSDIRHLIW
SVNETICYLSGFFELQPGDLIFTGTPEGVGPVVKGDVITGNVEGLTPIAVKIV