Protein Info for KEDOAH_04570 in Escherichia coli ECRC99

Name: dusC
Annotation: tRNA dihydrouridine(16) synthase DusC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF01207: Dus" amino acids 4 to 307 (304 residues), 324.6 bits, see alignment E=2.9e-101

Best Hits

Swiss-Prot: 100% identical to DUSC_ECO57: tRNA-dihydrouridine(16) synthase (dusC) from Escherichia coli O157:H7

KEGG orthology group: K05541, tRNA-dihydrouridine synthase C [EC: 1.-.-.-] (inferred from 99% identity to eco:b2140)

MetaCyc: 99% identical to tRNA-dihydrouridine16 synthase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA-dihydrouridine synthase C (EC 1.-.-.-)" in subsystem Murein hydrolase regulation and cell death (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>KEDOAH_04570 tRNA dihydrouridine(16) synthase DusC (Escherichia coli ECRC99)
MRVLLAPMEGVLDSLVRELLTEVNDYDLCITEFVRVVDQLLPVKVFHRICPELQNASRTP
SGTLVRVQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNGSGGGATLLKDPELIY
QGAKAMREAVPAHLPVSVKVRLGWDSGEKKFEIADAVQQAGATELVVHGRTKEQGYRAEH
IDWQAIGEIRQRLNIPVIANGEIWDWQSAQECMAISGCDSVMIGRGALNIPNLSRVVKYN
EPRMPWPEVVALLQKYTRLEKQGDTGLYHVARIKQWLSYLRKEYDEATELFQHVRVLNNS
PDIARAIQAIDIGKLR