Protein Info for KEDOAH_04035 in Escherichia coli ECRC99

Name: gatY
Annotation: tagatose-bisphosphate aldolase subunit GatY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00167: ketose-bisphosphate aldolase" amino acids 1 to 284 (284 residues), 368.1 bits, see alignment E=3.4e-114 TIGR01858: class II aldolase, tagatose bisphosphate family" amino acids 3 to 284 (282 residues), 539.5 bits, see alignment E=1.4e-166 PF01116: F_bP_aldolase" amino acids 4 to 283 (280 residues), 346.5 bits, see alignment E=6.3e-108

Best Hits

Swiss-Prot: 100% identical to GATY_ECO5E: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 99% identity to eco:b2096)

MetaCyc: 99% identical to tagatose-1,6-bisphosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>KEDOAH_04035 tagatose-bisphosphate aldolase subunit GatY (Escherichia coli ECRC99)
MYVVSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTE
NLLALVSAMAKHYHHPLAIHLDHHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEV
VDFCHRFDVSVEAELGQLGGQEDDVQVNEADAFYTNPAQAREFAEATGIDSLAVAIGTAH
GMYASAPALDFSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFS
QALKNYLTEHPEATDPRDYLQSAKSAMRDVVSKVIADCGCEGRA