Protein Info for KEDOAH_03770 in Escherichia coli ECRC99

Name: wzxC
Annotation: colanic acid undecaprenyl disphosphate flippase WzxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 67 (26 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 202 to 217 (16 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 414 to 438 (25 residues), see Phobius details amino acids 444 to 467 (24 residues), see Phobius details PF01943: Polysacc_synt" amino acids 11 to 276 (266 residues), 240 bits, see alignment E=3.3e-75 PF13440: Polysacc_synt_3" amino acids 31 to 325 (295 residues), 229 bits, see alignment E=7.9e-72

Best Hits

Swiss-Prot: 99% identical to WZXC_ECOLI: Lipopolysaccharide biosynthesis protein WzxC (wzxC) from Escherichia coli (strain K12)

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 99% identity to eco:b2046)

MetaCyc: 99% identical to colanic acid repeat unit flippase (Escherichia coli K-12 substr. MG1655)
RXN-22217

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>KEDOAH_03770 colanic acid undecaprenyl disphosphate flippase WzxC (Escherichia coli ECRC99)
MSLREKTISGAKWSAIATVIIIGLGLVQMTVLARIIDNHQFGLLTVSLVIIALADTLSDF
GIANSIIQRKEISHLELTTLYWLNVGLGLVVCVAVFLLSDLIGDVLNNPDLAPLIKTLSL
AFVVIPHGQQFRALMQKELEFNKIGMIETSAVLAGFTFTVVSAHFWPLAMTAILGYLVNS
AVRTLLFGYFGRKIYRPGLHFSLASVAPNLRFGAWLTADSIINYLNTNLSTLVLARILGA
GVAGGYNLAYNVAVVPPMKLNPIITRVLFPAFAKIQDDTEKLRVNFYKLLSVVGIINFPA
LLGLMVVSNNFVPLVFGEKWNSIIPVLQLLCVVGLLRSVGNPIGSLLMAKARVDISFKFN
VFKTFLFIPAIVIGGQMAGAIGVTLGFLLVQIINTILSYFVMIKPVLGSSYRQYILSLWL
PFYLSLPTLVVSYVLGIVLKGQLALGMLLAVQIAAGVLAFVVMIVLSRHPLVVEVKRQFC
RSEKMKMLLRAG