Protein Info for KEDOAH_03725 in Escherichia coli ECRC99

Name: wzx
Annotation: O157 family O-antigen flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 405 to 422 (18 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details PF01554: MatE" amino acids 278 to 421 (144 residues), 32.1 bits, see alignment E=4.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_2971)

MetaCyc: 100% identical to Escherichia coli O:157 antigen repeat unit flippase (Escherichia coli O157)
7.5.99.a [EC: 7.5.99.a]

Predicted SEED Role

"O-antigen flippase Wzx" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.99.a

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>KEDOAH_03725 O157 family O-antigen flippase (Escherichia coli ECRC99)
MIMNKIKKILKFCTLKKYDTSSALGREQERYRIISLSVISSLISKILSLLSLILTVSLTL
PYLGQERFGVWMTITSLGAALTFLDLGIGNALTNRIAHSFACGKNLKMSRQISGGLTLLA
GLSFVITAICYITSGMIDWQLVIKGINENVYAELQHSIKVFVIIFGLGIYSNGVQKVYMG
IQKAYISNIVNAIFILLSIITLVISSKLHAGLPVLIVSTLGIQYISGIYLTINLIIKRLI
KFTKVNIHAKREAPYLILNGFFFFILQLGTLATWSGDNFIISITLGVTYVAVFSITQRLF
QISTVPLTIYNIPLWAAYADAHARNDTQFIKKTLRTSLKIVGISSFLLAFILVVFGSEVV
NIWTEGKIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNIVKQQMLAVVTLILIAIPAKY
IIVSHFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG