Protein Info for KEDOAH_03685 in Escherichia coli ECRC99

Name: perB
Annotation: GDP-perosamine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF17836: PglD_N" amino acids 6 to 83 (78 residues), 28.5 bits, see alignment E=1.9e-10 TIGR03570: sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family" amino acids 6 to 212 (207 residues), 170.8 bits, see alignment E=1.4e-54

Best Hits

Swiss-Prot: 100% identical to PERB_ECO57: GDP-perosamine N-acetyltransferase (perB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ece:Z3192)

MetaCyc: 100% identical to GDP-perosamine N-acetyltransferase monomer (Escherichia coli O157:H7)
RXN-14698 [EC: 2.3.1.227]

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.227 or 2.5.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>KEDOAH_03685 GDP-perosamine N-acetyltransferase (Escherichia coli ECRC99)
MNLYGIFGAGSYGRETIPILNQQIKQECGSDYALVFVDDVLAGKKVNGFEVLSTNCFLKA
PYLKKYFNVAIANDKIRQRVSESILLHGVEPITIKHPNSVVYDHTMIGSGAIISPFVTIS
TNTHIGRFFHANIYSYVAHDCQIGDYVTFAPGAKCNGYVVIEDNAYIGSGAVIKQGVPNR
PLIIGAGAIIGMGAVVTKSVPAGITVCGNPAREMKRSPTSI