Protein Info for KEDOAH_01410 in Escherichia coli ECRC99

Name: cdgI
Annotation: putative diguanylate cyclase CdgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details PF17158: MASE4" amino acids 44 to 275 (232 residues), 179.4 bits, see alignment E=8e-57 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 282 to 444 (163 residues), 122.7 bits, see alignment E=6.1e-40 PF00990: GGDEF" amino acids 284 to 441 (158 residues), 152.5 bits, see alignment E=8.8e-49

Best Hits

Swiss-Prot: 100% identical to CDGI_ECOLI: Probable diguanylate cyclase CdgI (cdgI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1785)

Predicted SEED Role

"Inner membrane protein YeaI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>KEDOAH_01410 putative diguanylate cyclase CdgI (Escherichia coli ECRC99)
MVSMGTQKLKAQSFFIFSLLLTLILFCITTLYNENTNVKLIPQMNYLMVVVALFFLNAVI
FLFMLMKYFTNKQILPTLILSLAFLSGLIYLVETIVIIHKPINGSTLIQTKSNDVSIFYI
FRQLSFICLTSLALFCYGKDNILDNNKKKTGILLLALIPFLVFPLLAHNLSSYNADYSLY
VVDYCPDNHTATWGINYTKILVCLWAFLLFFIIMRTRLASELWPLIALLCLASLCCNLLL
LTLDEYNYTIWYISRGIEVSSKLFVVSFLIYNIFQELQLSSKLAVHDVLTNIYNRRYFFN
SVESLLSRPVVKDFCVMLVDINQFKRINAQWGHRVGDKVLVSIVDIIQQSIRPDDILARL
EGEVFGLLFTELNSAQAKIIAERMRKNVELLTGFSNRYDVPEQMTISIGTVFSTGDTRNI
SLVMTEADKALREAKSEGGNKVIIHHI