Protein Info for KEDOAH_01135 in Escherichia coli ECRC99

Name: chbR
Annotation: transcriptional regulator ChbR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF07883: Cupin_2" amino acids 27 to 80 (54 residues), 33.4 bits, see alignment E=5.8e-12 PF02311: AraC_binding" amino acids 37 to 80 (44 residues), 21.5 bits, see alignment 3.3e-08 PF12833: HTH_18" amino acids 201 to 272 (72 residues), 70.7 bits, see alignment E=2.2e-23 PF00165: HTH_AraC" amino acids 234 to 272 (39 residues), 43 bits, see alignment 7.3e-15

Best Hits

Swiss-Prot: 100% identical to CHBR_ECOLI: HTH-type transcriptional regulator ChbR (chbR) from Escherichia coli (strain K12)

KEGG orthology group: K03490, AraC family transcriptional regulator, cel operon repressor (inferred from 100% identity to eco:b1735)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>KEDOAH_01135 transcriptional regulator ChbR (Escherichia coli ECRC99)
MQPVINAPEIATAREQQLFNGKNFHVFIYNKTESISGLHQHDYYEFTLVLTGRYFQEING
KRVLLERGDFVFIPLGSHHQSFYEFGATRILNVGISKRFFEQHYLPLLPYCFVASQVYRT
NNAFLTYVETVISSLNFRETGLEEFVEMVTFYVINRLRHYREEQVIDDVPQWLKSTVEKM
HDKEQFSESALENMVTLSAKSQEYLTRATQRYYGKTPMQIINEIRINFAKKQLEMTNYSV
TDIAFEAGYSSPSLFIKTFKKLTSFTPKSYRKKLTEFNQ