Protein Info for KEDOAH_00745 in Escherichia coli ECRC99

Name: ribE
Annotation: riboflavin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 202 (202 residues), 304.2 bits, E=1.5e-95
• PF00677: Lum_binding
  • amino acids 3 to 87 (85 residues), 80.4 bits, E=4.2e-27
  • amino acids 100 to 185 (86 residues), 85.6 bits, E=9.8e-29

Best Hits

Swiss-Prot: 100% identical to RISA_ECOLI: Riboflavin synthase (ribC) from Escherichia coli (strain K12)

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 100% identity to eco:b1662)

MetaCyc: 100% identical to riboflavin synthase (Escherichia coli K-12 substr. MG1655)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Protein Sequence (213 amino acids)

>KEDOAH_00745 riboflavin synthase (Escherichia coli ECRC99)
MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVS
FDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGHLMSGHIMTTAEVAKILTSENNRQ
IWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLERTTLGKKKLGARV
NIEIDPQTQAVVDTVERVLAARENAMNQPGTEA