Protein Info for KEDOAH_00495 in Escherichia coli ECRC99

Name: lacZ
Annotation: Beta-galactosidase/beta-glucuronidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02837: Glyco_hydro_2_N
  • amino acids 12 to 180 (169 residues), 218.6 bits, E=2.6e-69

Predicted SEED Role

"Beta-glucuronidase (EC 3.2.1.31)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 3.2.1.31)

MetaCyc Pathways

• superpathway of hexuronide and hexuronate degradation (10/10 steps found)
• superpathway of β-D-glucuronosides degradation (7/7 steps found)
• β-D-glucuronide and D-glucuronate degradation (3/3 steps found)
• luteolin triglucuronide degradation (3/4 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Flavone and flavonol biosynthesis
• Glycosaminoglycan degradation
• Pentose and glucuronate interconversions
• Porphyrin and chlorophyll metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.31

Use Curated BLAST to search for 3.2.1.31

Protein Sequence (237 amino acids)

>KEDOAH_00495 Beta-galactosidase/beta-glucuronidase (Escherichia coli ECRC99)
MLRPVETPTREIEKLDGLWAFSLDRENCGIEQRWWESALQESRAIAVPGSFNDQFADADI
RNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTP
YVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTP
NTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGAPAGLCKW