Protein Info for KEDOAH_00405 in Escherichia coli ECRC99

Name: tqsA
Annotation: AI-2 transporter TqsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 288 to 315 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 328 (315 residues), 270.1 bits, see alignment E=1.4e-84

Best Hits

Swiss-Prot: 99% identical to TQSA_SHIFL: AI-2 transport protein TqsA (tqsA) from Shigella flexneri

KEGG orthology group: K11744, AI-2 transport protein TqsA (inferred from 99% identity to eco:b1601)

MetaCyc: 99% identical to autoinducer 2 exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-453

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>KEDOAH_00405 AI-2 transporter TqsA (Escherichia coli ECRC99)
MAKPLITLNGLKIVIMLGMLVIILCGIRFAAEIIVPFILALFIAVILNPLVQHMVRWRVP
RVLAVSILMTIIVMAMVLLLAYLGSTLNELTRTLPQYRNSIMTPLQALEPLLQRVGIDVS
VDQLAHYIDPNAAMTLLTNLLTQLSNAMSSIFLLLLTVLFMLLEVPQLPGKFKQMMARPV
EGMAAIQRAIDSVSHYLVLKTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIG
SVLAAIPPIAQVLVFNGFYEALLVLAGYLLINLVFGNILEPRIMGRGLGLSTLVVFLSLI
FWGWLLGPVGMLLSVPLTIIVKIALEQTAGGQSIAVLLSDLNKE