Protein Info for JDDGAC_30250 in Escherichia coli ECRC98

Name: rfaB
Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 124 to 143 (20 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 13 to 159 (147 residues), 62.6 bits, see alignment E=1.7e-20 PF13579: Glyco_trans_4_4" amino acids 14 to 157 (144 residues), 40.3 bits, see alignment E=1.5e-13 PF13477: Glyco_trans_4_2" amino acids 22 to 101 (80 residues), 33.7 bits, see alignment E=1.4e-11 PF00534: Glycos_transf_1" amino acids 182 to 340 (159 residues), 106 bits, see alignment E=5.9e-34 PF13692: Glyco_trans_1_4" amino acids 186 to 326 (141 residues), 86.5 bits, see alignment E=7.4e-28 PF20706: GT4-conflict" amino acids 259 to 352 (94 residues), 43.2 bits, see alignment E=9.7e-15 PF13524: Glyco_trans_1_2" amino acids 265 to 355 (91 residues), 29.6 bits, see alignment E=2.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to eoh:ECO103_p21)

Predicted SEED Role

"Hexosyltransferase homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>JDDGAC_30250 glycosyl transferase (Escherichia coli ECRC98)
MMKILFTESSSDIGGQELQALAQMTALQKQGHSVLLACREKSKIAPEARKRGHDVTFIPF
RNSLHLPSILRLRRIIGEFKPDLVICHSGHDSNIAGLSRLICCHRFSIVRQKTYITRKTR
TFSLNYLCDFIVVPSSAMMAHLMAEGVRTPVTVIPPGFDWPALHNEAMRPLPLHIHAWAA
SADNVPLIVQVGMLRPEKGHEFMLRVLYQLKMEGKSFRWLVVGAGREEYEARLRQQTEHL
GMSGDVLMAGALFPALPVYRIASVVVMPSENEAFGMVLAEASVSGVPVIASETGGIPDVI
QKNVTGTLLPVGDVSAWTGALRDFLSRPERFRMMAASAREDIEYRFDINRTAQIIVSLAS
QAKGKCNR