Protein Info for JDDGAC_30145 in Escherichia coli ECRC98

Name: dAP2
Annotation: Uncharacterized protein in traX-finO intergenic region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00561: Abhydrolase_1" amino acids 26 to 268 (243 residues), 117.9 bits, see alignment E=2.2e-37 PF12146: Hydrolase_4" amino acids 27 to 262 (236 residues), 72.1 bits, see alignment E=1.5e-23 PF12697: Abhydrolase_6" amino acids 28 to 244 (217 residues), 32 bits, see alignment E=7.3e-11 PF02129: Peptidase_S15" amino acids 49 to 247 (199 residues), 55 bits, see alignment E=3.6e-18 PF00326: Peptidase_S9" amino acids 49 to 135 (87 residues), 34.7 bits, see alignment E=4.6e-12

Best Hits

Swiss-Prot: 96% identical to YPT2_ECOLX: Uncharacterized 31.7 kDa protein in traX-finO intergenic region from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to ecw:EcE24377A_F0031)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>JDDGAC_30145 Uncharacterized protein in traX-finO intergenic region (Escherichia coli ECRC98)
MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPCFANAFTEAGFATITFD
YRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIGLWGTSLGGGHVFSAAAQD
QRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAEKKKNTGKEMFVGVTRVLSDD
ESKVFFEKIKARHPEMDIKIPFLTVMETLQYKPAESAASVQCPVLVVIAGQDSVNPPEQG
RALYDAVASGTKELYEEADACHYDIYEGAFFERVVAVQTQWFKQYL