Protein Info for JDDGAC_29340 in Escherichia coli ECRC98

Name: mtfA
Annotation: DgsA anti-repressor MtfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF06167: Peptidase_M90" amino acids 12 to 243 (232 residues), 205.9 bits, see alignment E=3.8e-65

Best Hits

Swiss-Prot: 100% identical to MTFA_ECO5E: Protein MtfA (mtfA) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K09933, hypothetical protein (inferred from 100% identity to eco:b1976)

MetaCyc: 100% identical to Mlc titration factor (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"FIG01220476: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>JDDGAC_29340 DgsA anti-repressor MtfA (Escherichia coli ECRC98)
MIKWPWKVQESAHQTALPWQEALSIPLLTCLTEQEQSKLVTLAERFLQQKRLVPLQGFEL
DSLRSCRIALLFCLPVLELGLEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHNQRIVQSGQ
SWQQGPIVLNWLDIQDSFDASGFNLIIHEVAHKLDTRNGDRASGVPFIPLREVAGWEHDL
HAAMNNIQEEIELVGENAASIDAYAASDPAECFAVLSEYFFSAPELFAPRFPSLWQRFCQ
FYQQDPLQRLHHANDTDSFSATNVH