Protein Info for JDDGAC_29280 in Escherichia coli ECRC98

Name: nac
Annotation: nitrogen assimilation transcriptional regulator NAC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 3 to 62 (60 residues), 74.6 bits, E=4.9e-25
• PF03466: LysR_substrate
  • amino acids 87 to 288 (202 residues), 113.7 bits, E=8.3e-37

Best Hits

Swiss-Prot: 99% identical to NAC_ECOLI: Nitrogen assimilation regulatory protein nac (nac) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1988)

Predicted SEED Role

"Nitrogen assimilation regulatory protein Nac" in subsystem DNA-binding regulatory proteins, strays

Protein Sequence (305 amino acids)

>JDDGAC_29280 nitrogen assimilation transcriptional regulator NAC (Escherichia coli ECRC98)
MNFRRLKYFVKIVDIGSLTQAAEVLHIAQPALSQQVATLEGELNQQLLIRTKRGVTPTDA
GKILYTHARAILRQCEQAQLAVHNVGQALSGQVSIGFAPGTAASSITMPLLQAVRAEFPE
VVIYLHENSGAVLNEKLINHQLDMAVIYEHSPVAGVSSQALLKEDLFLVGTQDCPGQSVD
VNAIAQMNLFLPSDYSAVRLRVDEAFSLRRLTAKVIGEIESIATLTAAIASGMGVAVLPE
SAARSLCGAVNGWMSRITTPSMSLSLSLNLPARANLSPQAQAVKELLMSVISSPVMEKRQ
WQLVS