Protein Info for JDDGAC_28520 in Escherichia coli ECRC98

Name: wcaA
Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF13641: Glyco_tranf_2_3" amino acids 5 to 136 (132 residues), 43.7 bits, see alignment E=4.7e-15 PF10111: Glyco_tranf_2_2" amino acids 7 to 130 (124 residues), 56.4 bits, see alignment E=5.2e-19 PF00535: Glycos_transf_2" amino acids 7 to 148 (142 residues), 120.9 bits, see alignment E=8.2e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecs:ECs2845)

MetaCyc: 100% identical to UDP-Glc:alpha-D-GalNAc-PP-Und beta-(1,3)-glucosyltransferase (Escherichia coli O157)
2.4.1.-

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.4.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>JDDGAC_28520 glycosyl transferase (Escherichia coli ECRC98)
MNKETVSIIMPVYNGAKTIISSVESIIHQSYQDFVLYIIDDCSTDDTFSLINSRYKNNQK
IRILRNKTNLGVAESRNYGIEMATGKYISFCDADDLWHEKKLERQIEVLNNECVDVVCSN
YYVIDNKRNIVGEVNAPHVINYRKMLMKNYIGNLTGIYNANKLGKFYQKKIGHEDYLMWL
EIINKTNGAICIQDNLAYYMRSNNSLSGNKIKAAKWTWSIYREHLHLSFPKTLYYFLLYA
SNGVMKKITHSLLRRKETKK