Protein Info for JDDGAC_27830 in Escherichia coli ECRC98

Annotation: sialate O-acetylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 PF08410: DUF1737" amino acids 3 to 53 (51 residues), 42.6 bits, see alignment 6.4e-15 PF03629: SASA" amino acids 83 to 278 (196 residues), 41.7 bits, see alignment E=1.6e-14 PF20350: DUF6645" amino acids 492 to 610 (119 residues), 245.6 bits, see alignment E=1.1e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_2958)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>JDDGAC_27830 sialate O-acetylesterase (Escherichia coli ECRC98)
MTFKHYDVVRAASPSDLADALAQKIREGWQPYGGPFSSYTDDGAALIQAIVAEGDVSTPV
VVKLTGGEGAVISATRDPEYYFIVVLAGQSNSMAYGEGLPLPETYDRPDPRIKQLARRST
VTPGGVACKYNDIIPADHCLHDVQDMSRLNHPKADLSKGQYGTVGQGLHIAKKLLPFIPA
NAGILLVPCCRGGSAFTTGADGTYSDASGASENSTRWGVDKPLYKDLIGRTKAALKKNPK
NVLFAVVWMQGEFDFGGTPANHAAQFGALVDKFRADLADMAGQCVGGSADGVPWICGDTT
YFWKQKNEATYQTVYGSYKNKTEKNIHFVPFMTDENGVNVPTNKPEEDPDIPGIGYYGSK
WRDSSATWTSQDRASHFSAWARRGIISDRLATAILRHAGRVALNAGASSTVSEVRPSSPS
GAEATGITTLLSYLASESEGSLKVQGWSASGGRAEVVSDAEGTGGKAVKLTKEAGKSSWV
LEYAAGNGAALLQKGGQIRCRFKVSGALAANQYVMAFYWPVSSLPQGVALTGDGGNNLLA
AFYIQTDAKDLNVMYHNAKVATNNLKLGSFGAFDNEWHALAFRFAGNNSLQVTPVIDGQD
GTPFTLTQSPVSAFAADKLHVTDITRGATYPVLIDSIAVEVNSTDTAA