Protein Info for JDDGAC_27565 in Escherichia coli ECRC98

Name: ubiH
Annotation: 3-hydroxybenzoate 6-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 5 to 346 (342 residues), 86.5 bits, E=5.3e-28
• PF12831: FAD_oxidored
  • amino acids 8 to 149 (142 residues), 31.5 bits, E=3.1e-11
• PF13450: NAD_binding_8
  • amino acids 9 to 40 (32 residues), 26.7 bits, see alignment (E = 1.4e-09)

Best Hits

Swiss-Prot: 91% identical to 3HBH_KLEOX: 3-hydroxybenzoate 6-hydroxylase (mhbM) from Klebsiella oxytoca

KEGG orthology group: K00480, salicylate hydroxylase [EC: 1.14.13.1] (inferred from 100% identity to eok:G2583_2678)

Predicted SEED Role

"Putative n-hydroxybenzoate hydroxylase" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• salicylate degradation I (1/1 steps found)
• chlorosalicylate degradation (2/7 steps found)
• superpathway of salicylate degradation (1/7 steps found)
• naphthalene degradation to acetyl-CoA (4/12 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (6/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Bile acid biosynthesis
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.1

Protein Sequence (397 amino acids)

>JDDGAC_27565 3-hydroxybenzoate 6-monooxygenase (Escherichia coli ECRC98)
MTKVTRAVIVGGGIGGAATALSLARLGIKVVLLEKAHEIGEIGAGIQLGPNAFSALDSLG
VGEVARQRAVFTDHITMMDAVNAEEVVCIETGQAFRDHFGGPYAVIHRVDIHASVWEAVL
THPDVEYHTSTNVVDIRETEDDVTVFDDRGNSWTGDILIGCDGVKSVVRQSLLGDAPRVT
GHVVYRAVIDRADMPEDLRINAPVLWAGPHCHLVHYPLRGGKQYNLVVTFHSRQQEEWGV
KDGSKEEVLSYFEGIHPRPRQMLDKPTSWRRWSTADREPVAKWGTKRITLVGDSAHPVAQ
YMAQGACMALEDAVTLGKALAQCEGDAAQAFALYESVRIPRTARIVWSTREMGRVYHAAG
VERQVRNLLWKGKSQAEFYRGMEWLYGWKEDNCLQPR