Protein Info for JDDGAC_27555 in Escherichia coli ECRC98

Name: ycgM
Annotation: 5-carboxymethyl-2-hydroxymuconate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 27 to 232 (206 residues), 183.5 bits, E=2.3e-58

Best Hits

Swiss-Prot: 40% identical to FAHD1_DICDI: Acylpyruvase FAHD1, mitochondrial (fahd1) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 100% identity to eok:G2583_2680)

MetaCyc: 56% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

• gentisate degradation I (2/3 steps found)
• L-tyrosine degradation I (3/5 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• 5-nitroanthranilate degradation (2/6 steps found)

KEGG Metabolic Maps

• Styrene degradation
• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2 or 3.7.1.20

Protein Sequence (233 amino acids)

>JDDGAC_27555 5-carboxymethyl-2-hydroxymuconate isomerase (Escherichia coli ECRC98)
MTQYVFEPQAPVTVPVVGSDEQFPVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADA
VVPVAAGETLALPYPAQTDNYHYEIELVVAIGKKGSDIPLEHAHEYVWGYATGLDMTRRD
RQMEMRQMGRPWEIGKAFDLSAPIAPLHKARDIGGIDNAPIWLQVNGEDHQRSDIRHLIW
SVNETICYLSGFFELQPGDLIFTGTPEGVGPVVKGDVITGNVEGLTPIAVKIV