Protein Info for JDDGAC_27445 in Escherichia coli ECRC98

Name: nfo
Annotation: deoxyribonuclease IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00587: apurinic endonuclease (APN1)" amino acids 2 to 276 (275 residues), 391 bits, see alignment E=1.4e-121 PF01261: AP_endonuc_2" amino acids 20 to 277 (258 residues), 225.6 bits, see alignment E=4.2e-71

Best Hits

Swiss-Prot: 100% identical to END4_ECODH: Probable endonuclease 4 (nfo) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K01151, deoxyribonuclease IV [EC: 3.1.21.2] (inferred from 100% identity to eco:b2159)

MetaCyc: 100% identical to endonuclease IV (Escherichia coli K-12 substr. MG1655)
3.1.4.-; 3.1.4.-; 3.1.3.-; Deoxyribonuclease IV (phage-T(4)-induced). [EC: 3.1.21.2]; 3.1.21.- [EC: 3.1.21.2]

Predicted SEED Role

"Endonuclease IV (EC 3.1.21.2)" in subsystem DNA repair, bacterial (EC 3.1.21.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>JDDGAC_27445 deoxyribonuclease IV (Escherichia coli ECRC98)
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYH
YTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEE
DCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDT
CHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIG
HDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA