Protein Info for JDDGAC_26685 in Escherichia coli ECRC98

Name: argT
Annotation: lysine/arginine/ornithine ABC transporter substrate-binding protein ArgT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 3 to 253 (251 residues), 333.3 bits, see alignment E=4.8e-104 PF00497: SBP_bac_3" amino acids 28 to 254 (227 residues), 208.5 bits, see alignment E=4.6e-66

Best Hits

Swiss-Prot: 99% identical to ARGT_ECOLI: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Escherichia coli (strain K12)

KEGG orthology group: K10013, lysine/arginine/ornithine transport system substrate-binding protein (inferred from 99% identity to eco:b2310)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>JDDGAC_26685 lysine/arginine/ornithine ABC transporter substrate-binding protein ArgT (Escherichia coli ECRC98)
MKKSILALSLLVGISAAASSYAALPETVRIGTDTTYAPFSSKDAKGDFVGFDIDLGNEMC
KRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAK
GSPIQPTLDSLKGKHVGVLQGSTQEAYANETWRSKGVDVVAYANQDLVYSDLAAGRLDAA
LQDEVAASEGFLKQPAGKDFAFAGSSVKDKKYFGDGTGVGLRKDDAELTAAFNKALGELR
QDGTYDKMAKKYFDFNVYGD