Protein Info for JDDGAC_26085 in Escherichia coli ECRC98

Name: murQ
Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00274: N-acetylmuramic acid 6-phosphate etherase
  • amino acids 6 to 296 (291 residues), 512.4 bits, E=1.5e-158
• PF01380: SIS
  • amino acids 129 to 208 (80 residues), 30 bits, E=6.1e-11

Best Hits

Swiss-Prot: 100% identical to MURQ_ECO5E: N-acetylmuramic acid 6-phosphate etherase (murQ) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 98% identity to eco:b2428)

MetaCyc: 98% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Protein Sequence (298 amino acids)

>JDDGAC_26085 N-acetylmuramic acid 6-phosphate etherase (Escherichia coli ECRC98)
MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVS
GGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGG
VNDLKNIGLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAI
TPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVN
IVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQHGGFIRQVLDKE