Protein Info for JDDGAC_25860 in Escherichia coli ECRC98

Name: dapA
Annotation: 4-hydroxy-tetrahydrodipicolinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00701: DHDPS
  • amino acids 2 to 288 (287 residues), 422.8 bits, E=2.3e-131
• TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase
  • amino acids 4 to 288 (285 residues), 421.2 bits, E=7.5e-131

Best Hits

Swiss-Prot: 100% identical to DAPA_ECOSM: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 100% identity to eco:b2478)

MetaCyc: 100% identical to 4-hydroxy-tetrahydrodipicolinate synthase (Escherichia coli K-12 substr. MG1655)
DIHYDRODIPICSYN-RXN [EC: 4.3.3.7]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Protein Sequence (292 amino acids)

>JDDGAC_25860 4-hydroxy-tetrahydrodipicolinate synthase (Escherichia coli ECRC98)
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVV
MMTLELADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFK
AIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDD
FVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLH
NKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL