Protein Info for JDDGAC_25590 in Escherichia coli ECRC98

Annotation: Head to tail connecting protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF12236: Head-tail_con" amino acids 15 to 499 (485 residues), 578.7 bits, see alignment E=4e-178

Best Hits

Swiss-Prot: 80% identical to PORTL_BPE15: Portal protein from Salmonella phage epsilon15

KEGG orthology group: None (inferred from 99% identity to ect:ECIAI39_2680)

Predicted SEED Role

"putative tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>JDDGAC_25590 Head to tail connecting protein (Escherichia coli ECRC98)
MAETTKERLNKQFAQLESERQSFEPHWRELSDYINPRGSRFLTSEVNRNDRRNTRIIDST
GTMAARTLASGMMSGITSPARPWFRLATPDPEMMDYGPVKLWLEAVQNRMNDMFNKSNLY
QSLPQLYGSLGTYSTGAMAVLDDDEDIIRTMPFPIGSYYLANSPRGSVDTCFRKFSMTVR
QLVQEFGLNNVSESVKSMWESGTYEKWIEVMHSVYPNIDRDTSKLDSKNKPFKSVYYEVG
GDNDKLLRESGFDEFPIMAPRWEVNGEDVYGSSCPGMLALGPVKALQLLQKRKSQLIDKA
TNPPMVAPTSLKNQRASLLPGDITYIDQITGQDGFRPAYLVNPSTADLVADIQDTRQIIN
SAYFVDLFMMLQNINTRSMPVEAVIEMKEEKLLMLGPVLERLNDECLNPLIDRSFSMMVR
KNMLPPPPDVMEGMPLKVEYISVMAQAQKSIGLSSLASTVNFIGQLAQVKPEALDKLNVD
QAIDAFADMSGVSPTVIVPQEQVEQARQQRAQQQQQQQMMAMGMAAAQGVKTLSEAKTSD
PSVLSAMANAVSGQGGQSQ