Protein Info for JDDGAC_25365 in Escherichia coli ECRC98

Name: dmsB
Annotation: dimethylsulfoxide reductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR02951: dimethylsulfoxide reductase, chain B" amino acids 14 to 175 (162 residues), 265.6 bits, see alignment E=8.4e-84 PF13247: Fer4_11" amino acids 71 to 165 (95 residues), 87.3 bits, see alignment E=2.4e-28 PF12797: Fer4_2" amino acids 103 to 123 (21 residues), 27.4 bits, see alignment (E = 7.7e-10) PF12837: Fer4_6" amino acids 103 to 126 (24 residues), 32.9 bits, see alignment (E = 1.5e-11) PF00037: Fer4" amino acids 105 to 126 (22 residues), 34.3 bits, see alignment (E = 5.2e-12)

Best Hits

Swiss-Prot: 59% identical to DMSB_SHIFL: Anaerobic dimethyl sulfoxide reductase chain B (dmsB) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eok:G2583_3046)

MetaCyc: 59% identical to dimethyl sulfoxide reductase subunit B (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>JDDGAC_25365 dimethylsulfoxide reductase subunit B (Escherichia coli ECRC98)
MSQFKEFASVSDKQLGFFIDSSRCSGCKACQVACKDKNNLEVGRRFRRVYEVNGGGFIAT
GEGGVSHNVFAYTLSVSCNHCADPICTKNCPTMAMHKRPGDGIVRVNTDKCVGCGYCAWS
CPYGAPQMNEQTGQMSKCDFCIDLQAKGEQPICVATCPLGAIKFGPIDELREKYGDVSDV
KGLPDSSITQPNLVIKPHQGAEKEASHHA