Protein Info for JDDGAC_25300 in Escherichia coli ECRC98

Name: iscU
Annotation: Iron-sulfur cluster assembly scaffold protein IscU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01592: NifU_N
  • amino acids 2 to 126 (125 residues), 186.4 bits, E=1.1e-59
• TIGR01999: FeS cluster assembly scaffold IscU
  • amino acids 3 to 126 (124 residues), 237.7 bits, E=1.2e-75

Best Hits

Swiss-Prot: 100% identical to ISCU_SHIFL: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Shigella flexneri

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 100% identity to eco:b2529)

MetaCyc: 100% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)

Protein Sequence (128 amino acids)

>JDDGAC_25300 Iron-sulfur cluster assembly scaffold protein IscU (Escherichia coli ECRC98)
MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKT
YGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIAD
YKSKREAK