Protein Info for JDDGAC_25015 in Escherichia coli ECRC98
Name: eamB
Annotation: cysteine/O-acetylserine transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to EAMB_ECO57: Cysteine/O-acetylserine efflux protein (eamB) from Escherichia coli O157:H7
KEGG orthology group: K11249, cysteine/O-acetylserine efflux protein (inferred from 100% identity to ecs:ECs3444)MetaCyc: 97% identical to cysteine/O-acetylserine exporter EamB (Escherichia coli K-12 substr. MG1655)
RXN0-1923; RXN0-1924
Predicted SEED Role
"Transporter, LysE family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (195 amino acids)
>JDDGAC_25015 cysteine/O-acetylserine transporter (Escherichia coli ECRC98) VTPTLLSAFWTYTLITAMTPGPNNILALSSATTHGFHQSTRVLAGMSLGFLIVMLLCAGI SFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKI ILYGVTALSTFVLPQTQALSWIVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI VLALLLIYCAVRIFY