Protein Info for JDDGAC_24995 in Escherichia coli ECRC98

Name: trxC
Annotation: thioredoxin TrxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF21352: Thio2_N" amino acids 4 to 29 (26 residues), 47.5 bits, see alignment 3.2e-16 PF00085: Thioredoxin" amino acids 37 to 136 (100 residues), 98.9 bits, see alignment E=3.8e-32 TIGR01068: thioredoxin" amino acids 45 to 138 (94 residues), 124.3 bits, see alignment E=1e-40 PF13098: Thioredoxin_2" amino acids 52 to 135 (84 residues), 41.3 bits, see alignment E=4.1e-14 PF13728: TraF" amino acids 59 to 116 (58 residues), 23.4 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 100% identical to THIO2_ECOL6: Thioredoxin 2 (trxC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 100% identity to eco:b2582)

MetaCyc: 100% identical to reduced thioredoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Thioredoxin 2 (EC 1.8.1.8)" (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>JDDGAC_24995 thioredoxin TrxC (Escherichia coli ECRC98)
MNTVCTHCQAINRIPDDRIEDAAKCGRCGHDLFDGEVINATGETLDKLLKDDLPVVIDFW
APWCGPCRNFAPIFEDVAQERSGKVRFVKVNTEAERELSSRFGIRSIPTIMIFKNGQVVD
MLNGAVPKAPFDSWLNESL