Protein Info for JDDGAC_24250 in Escherichia coli ECRC98

Name: hycD
Annotation: formate hydrogenlyase subunit HycD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details PF00146: NADHdh" amino acids 9 to 301 (293 residues), 179.1 bits, see alignment E=6.5e-57

Best Hits

Swiss-Prot: 99% identical to HYCD_ECOLI: Formate hydrogenlyase subunit 4 (hycD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2722)

MetaCyc: 99% identical to hydrogenase 3 membrane subunit HycD (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 4" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>JDDGAC_24250 formate hydrogenlyase subunit HycD (Escherichia coli ECRC98)
MSVLYPLIQALVLFAVAPLLSGITRVARARLHNRRGPGVLQEYRDIIKLLGRQSVGPDAS
GWVFRLTPYVMVGVMLTIATALPVVTVGSPLPQLGDLITLLYLFAIARFFFAISGLDTGS
PFTAIGASREAMLGVLVEPMLLLGLWVAAQVASSTNISNITDTVYHWPLSQSIPLVLALC
ACAFATFIEMGKLPFDLAEAEQELQEGPLSEYSGSGFGVMKWGISLKQLVVLQMFVGVFI
PWGQMETFTVGGLLLALVIAIVKLVVGVLVIALFENSMARLRLDITPRITWAGFGFAFLA
FVSLLAA