Protein Info for JDDGAC_24215 in Escherichia coli ECRC98

Name: hypD
Annotation: hydrogenase formation protein HypD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00075: hydrogenase expression/formation protein HypD" amino acids 2 to 372 (371 residues), 597.9 bits, see alignment E=3.4e-184 PF01924: HypD" amino acids 15 to 367 (353 residues), 499.6 bits, see alignment E=2.5e-154

Best Hits

Swiss-Prot: 100% identical to HYPD_ECOLI: Hydrogenase maturation factor HypD (hypD) from Escherichia coli (strain K12)

KEGG orthology group: K04654, hydrogenase expression/formation protein HypD (inferred from 100% identity to eco:b2729)

MetaCyc: 100% identical to Fe-(CN)2CO cofactor assembly scaffold protein HypD (Escherichia coli K-12 substr. MG1655)
RXN-22646; RXN-22647

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypD" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>JDDGAC_24215 hydrogenase formation protein HypD (Escherichia coli ECRC98)
MRFVDEYRAPEQVMQLIEHLRERASHLSYTAERPLRIMEVCGGHTHAIFKFGLDQLLPEN
VEFIHGPGCPVCVLPMGRIDTCVEIASHPEVIFCTFGDAMRVPGKQGSLLQAKARGADVR
IVYSPMDALKLAQENPTRKVVFFGLGFETTMPTTAITLQQAKARDVQNFYFFCQHITLIP
TLRSLLEQPDNGIDAFLAPGHVSMVIGTDAYNFIASDFQRPLVVAGFEPLDLLQGVVMLV
EQKIAAHSKVENQYRRVVPDAGNLLAQQAIADVFCVNGDSEWRGLGVIESSGVHLTPDYQ
RFDAEAHFRPAPQQVCDDPRARCGEVLTGKCKPHQCPLFGNTCNPQTAFGALMVSSEGAC
AAWYQYRQQESEA