Protein Info for JDDGAC_24180 in Escherichia coli ECRC98
Name: ecdD
Annotation: Protein EcdD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
Swiss-Prot: 100% identical to ECDD_ECO57: Protein EcdD (ecdD) from Escherichia coli O157:H7
KEGG orthology group: None (inferred from 91% identity to sek:SSPA2591)Predicted SEED Role
"Hydroxyaromatic non-oxidative decarboxylase protein D (EC 4.1.1.-)" (EC 4.1.1.-)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Ascorbate and aldarate metabolism
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Fluorene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Purine metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.-
Use Curated BLAST to search for 4.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (78 amino acids)
>JDDGAC_24180 Protein EcdD (Escherichia coli ECRC98) MICPRCADEQIEVMAKSPVKDVWTVYQCQHCLYTWRDTEPLRRTSREHYPEAFRMTQKDI DDAPMVPSIPPLLAEGKR