Protein Info for JDDGAC_24175 in Escherichia coli ECRC98

Name: edcC
Annotation: Phenolic acid decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 441 (436 residues), 417.8 bits, E=2.4e-129
• PF20695: UbiD_N
  • amino acids 10 to 90 (81 residues), 53.1 bits, E=4.2e-18
• PF01977: UbiD
  • amino acids 109 to 309 (201 residues), 184.5 bits, E=2.1e-58
• PF20696: UbiD_C
  • amino acids 315 to 438 (124 residues), 110.4 bits, E=9.4e-36

Best Hits

Swiss-Prot: 100% identical to YCLC_ECO57: Phenolic acid decarboxylase (edcC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eoi:ECO111_3462)

Predicted SEED Role

"Hydroxyaromatic non-oxidative decarboxylase protein C (EC 4.1.1.-)" (EC 4.1.1.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Protein Sequence (475 amino acids)

>JDDGAC_24175 Phenolic acid decarboxylase (Escherichia coli ECRC98)
MAFDDLRSFLQALDDHGQLLKISEEVNAEPDLAAAANATGRIGDGAPALWFDNIRGFTDA
RVAMNTIGSWQNHAISLGLPPNTPVKKQIDEFIRRWDNFPIAPERRANPAWAQNTVDGDE
INLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVGIYRMEVKGKRKLGLQPV
PMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYDQSEYEMAGALRESPYPIA
TAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTGHYSGGRNMTVVRIDKVSYRTRPI
FESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVNAMYTHGLLAIISTKKRYGGF
ARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWALSSKVNPAGDLVQLPNMSVLE
LDPGSSPAGITDKLIIDATTPVAPDNRGHYSQPVVDLPETKAWAEKLTAMLAARK