Protein Info for JDDGAC_23805 in Escherichia coli ECRC98
Name: fucU
Annotation: L-fucose mutarotase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to FUCM_ECO45: L-fucose mutarotase (fucU) from Escherichia coli O45:K1 (strain S88 / ExPEC)
KEGG orthology group: K02431, L-fucose mutarotase [EC: 5.1.3.-] (inferred from 100% identity to eco:b2804)MetaCyc: 100% identical to L-fucose mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5304 [EC: 5.4.99.62]; RXN0-5298 [EC: 5.4.99.62, 5.1.3.29]
Predicted SEED Role
"L-fucose mutarotase" in subsystem L-fucose utilization
MetaCyc Pathways
- superpathway of fucose and rhamnose degradation (12/12 steps found)
- L-fucose degradation I (4/4 steps found)
- ribose phosphorylation (2/2 steps found)
- L-fucose degradation II (1/5 steps found)
- L-fucose degradation III (2/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.1.3.-
Use Curated BLAST to search for 5.1.3.- or 5.1.3.29 or 5.4.99.62
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (140 amino acids)
>JDDGAC_23805 L-fucose mutarotase (Escherichia coli ECRC98) MLKTISPLISPELLKVLAEMGHGDEIIFSDAHFPAHSMGPQVIRADGLLVSDLLQAIIPL FELDSYAPPLVMMAAVEGDTLDPEVERRYRNALSLQAPCPDIIRINRFAFYERAQKAFAI VITGERAKYGNILLKKGVTP