Protein Info for JDDGAC_23670 in Escherichia coli ECRC98

Name: ptsP
Annotation: phosphoenolpyruvate--protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 PF01590: GAF" amino acids 18 to 153 (136 residues), 63.8 bits, see alignment E=7.7e-21 PF13492: GAF_3" amino acids 20 to 152 (133 residues), 31.8 bits, see alignment E=5e-11 PF13185: GAF_2" amino acids 20 to 154 (135 residues), 55.4 bits, see alignment E=2.5e-18 PF05524: PEP-utilisers_N" amino acids 174 to 294 (121 residues), 87.5 bits, see alignment E=2.3e-28 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 175 to 729 (555 residues), 416.3 bits, see alignment E=9.2e-129 PF00391: PEP-utilizers" amino acids 320 to 391 (72 residues), 56 bits, see alignment E=7.8e-19 PF02896: PEP-utilizers_C" amino acids 420 to 707 (288 residues), 386 bits, see alignment E=3.2e-119

Best Hits

Swiss-Prot: 100% identical to PT1P_ECOLI: Phosphoenolpyruvate-dependent phosphotransferase system (ptsP) from Escherichia coli (strain K12)

KEGG orthology group: K08484, phosphotransferase system, enzyme I, PtsP [EC: 2.7.3.9] (inferred from 100% identity to ecw:EcE24377A_3149)

MetaCyc: 100% identical to phosphoenolpyruvate-protein phosphotransferase PtsP (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (748 amino acids)

>JDDGAC_23670 phosphoenolpyruvate--protein phosphotransferase (Escherichia coli ECRC98)
MLTRLREIVEKVASAPRLNEALNILVTDICLAMDTEVCSVYLADHDRRCYYLMATRGLKK
PRGRTVTLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKEERFRAFLGVPIIQRRQ
LLGVLVVQQRELRQYDESEESFLVTLATQMAAILSQSQLTALFGQYRQTRIRALPAAPGV
AIAEGWQDATLPLMEQVYQASTLDPALERERLTGALEEAANEFRRYSKRFAAGAQKETAA
IFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAEQFAALSDNYLKERAGDLRA
LGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQDRLVGVVVRDGAANSHAAIM
VRALGIPTVMGADIQPSVLHRRTLIVDGYRGELLVDPEPVLLQEYQRLISEEIELSRLAE
DDVNLPAQLKSGERIKVMLNAGLSPEHEEKLGSRIDGIGLYRTEIPFMLQSGFPSEEEQV
AQYQGMLQMFNDKPVTLRTLDVGADKQLPYMPISEENPCLGWRGIRITLDQPEIFLIQVR
AMLRANAATGNLNILLPMVTSLDEVDEARRLIERAGREVEEMIGYEIPKPRIGIMLEVPS
MVFMLPHLAKRVDFISVGTNDLTQYILAVDRNNTRVANIYDSLHPAMLRALAMIAREAEI
HGIDLRLCGEMAGDPMCVAILIGLGYRHLSMNGRSVARVKYLLRRIDYAEAENLAQRSLE
AQLATEVRHQVAAFMERRGMGGLIRGGL