Protein Info for JDDGAC_23210 in Escherichia coli ECRC98

Name: xerD
Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF02899: Phage_int_SAM_1" amino acids 8 to 90 (83 residues), 90 bits, see alignment E=1e-29 TIGR02225: tyrosine recombinase XerD" amino acids 9 to 298 (290 residues), 397.8 bits, see alignment E=1.4e-123 PF00589: Phage_integrase" amino acids 112 to 285 (174 residues), 202 bits, see alignment E=6.5e-64

Best Hits

Swiss-Prot: 100% identical to XERD_ECOLI: Tyrosine recombinase XerD (xerD) from Escherichia coli (strain K12)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to eco:b2894)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>JDDGAC_23210 site-specific tyrosine recombinase XerD (Escherichia coli ECRC98)
VKQDLARIEQFLDALWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLA
ERLEGGYKATSSARLLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVER
LLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVP
LGEEAVYWLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEK
LSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA