Protein Info for JDDGAC_22650 in Escherichia coli ECRC98

Name: hybB
Annotation: Ni/Fe-hydrogenase cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 79 (28 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF03916: NrfD" amino acids 46 to 330 (285 residues), 66.4 bits, see alignment E=1.8e-22

Best Hits

Swiss-Prot: 100% identical to HYBB_ECOLI: Probable Ni/Fe-hydrogenase 2 b-type cytochrome subunit (hybB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2995)

MetaCyc: 100% identical to hydrogenase 2 membrane subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ni/Fe-hydrogenase 2 B-type cytochrome subunit" in subsystem Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>JDDGAC_22650 Ni/Fe-hydrogenase cytochrome b subunit (Escherichia coli ECRC98)
MSHDPQPLGGKIISKPVMIFGPLIVICMLLIVKRLVFGLGSVSDLNGGFPWGVWIAFDLL
IGTGFACGGWALAWAVYVFNRGQYHPLVRPALLASLFGYSLGGLSITIDVGRYWNLPYFY
IPGHFNVNSVLFETAVCMTIYIGVMALEFAPALFERLGWKVSLQRLNKVMFFIIALGALL
PTMHQSSMGSLMISAGYKVHPLWQSYEMLPLFSLLTAFIMGFSIVIFEGSLVQAGLRGNG
PDEKSLFVKLTNTISVLLAIFIVLRFGELIYRDKLSLAFAGDFYSVMFWIEVLLMLFPLV
VLRVAKLRNDSRMLFLSALSALLGCATWRLTYSLVAFNPGGGYAYFPTWEELLISIGFVA
IEICAYIVLIRLLPILPPLKQNDHNRHEASKA