Protein Info for JDDGAC_22535 in Escherichia coli ECRC98

Name: parC_S129P
Annotation: DNA topoisomerase IV subunit A ParC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 5 to 738 (734 residues), 1425.5 bits, see alignment E=0 PF00521: DNA_topoisoIV" amino acids 29 to 466 (438 residues), 493.8 bits, see alignment E=4.6e-152 PF03989: DNA_gyraseA_C" amino acids 593 to 631 (39 residues), 23.2 bits, see alignment 3.7e-09 amino acids 641 to 675 (35 residues), 25.3 bits, see alignment (E = 8.3e-10)

Best Hits

Swiss-Prot: 100% identical to PARC_SHIFL: DNA topoisomerase 4 subunit A (parC) from Shigella flexneri

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 100% identity to ect:ECIAI39_3513)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (752 amino acids)

>JDDGAC_22535 DNA topoisomerase IV subunit A ParC (Escherichia coli ECRC98)
MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKF
KKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY
TESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDI
PPHNLREVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVR
MRAVWKKEDGAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIV
PRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRR
RLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILEL
KLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDDRRSPL
QEREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSN
QPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLLMASDA
GYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDL
PQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLTIHVGKRKIKLRPEELQKVTGE
RGRRGTLMRGLQRIDRVEIDSPRRASSGDSEE