Protein Info for JDDGAC_22035 in Escherichia coli ECRC98

Name: tdcB
Annotation: bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 25 to 312 (288 residues), 269.9 bits, E=1.4e-84
• TIGR01127: threonine ammonia-lyase
  • amino acids 28 to 323 (296 residues), 385.3 bits, E=1.6e-119

Best Hits

Swiss-Prot: 100% identical to TDCB_ECOLI: L-threonine dehydratase catabolic TdcB (tdcB) from Escherichia coli (strain K12)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to eco:b3117)

MetaCyc: 100% identical to catabolic threonine dehydratase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]; L-serine ammonia-lyase. [EC: 4.3.1.19, 4.3.1.17]

Predicted SEED Role

"Threonine dehydratase, catabolic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Glycine and Serine Utilization or Threonine anaerobic catabolism gene cluster or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-methionine degradation II (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• L-threonine degradation V (1/2 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17, 4.3.1.19

Use Curated BLAST to search for 4.3.1.17 or 4.3.1.19

Protein Sequence (329 amino acids)

>JDDGAC_22035 bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB (Escherichia coli ECRC98)
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA